"context" : "", "actions" : [ "event" : "removeThreadUserEmailSubscription", } { ;(function($) { { "includeRepliesModerationState" : "false", "action" : "pulsate" { { { "truncateBody" : "true", "kudosLinksDisabled" : "false", }; "action" : "pulsate" "action" : "rerender" "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ { "revokeMode" : "true", var keycodes = { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); ] "context" : "", "event" : "expandMessage", "event" : "markAsSpamWithoutRedirect", { LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "ProductAnswerComment", }, "actions" : [ $('.css-menu').removeClass('cssmenu-open') }); "event" : "AcceptSolutionAction", "actions" : [ }, }, } LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'DH5Mje4fjZabC5lYa6muVdXu4037eigbuV69ehcADKE. "context" : "envParam:quiltName,message", }, "context" : "envParam:selectedMessage", "action" : "rerender" "context" : "envParam:quiltName", if ( neededkeys[count] == key ) { }, } "actions" : [ } "useSubjectIcons" : "true", Bist du sicher, dass du fortfahren möchtest? } "disableLabelLinks" : "false", "action" : "rerender" "context" : "envParam:quiltName", "actions" : [ ] return; "action" : "rerender" "event" : "expandMessage", "context" : "lia-deleted-state", { { "event" : "kudoEntity", "action" : "rerender" // enable redirect to login page when "logmein" is typed into the void =) }, { "event" : "editProductMessage", "actions" : [ { "disableKudosForAnonUser" : "false", lithadmin: [] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_17c878f5cafef8","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_17c878f5cafef8_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/Archiv_Mobilfunk/thread-id/225454&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"s4DgoI3zhPDjPKyZkesPaM3eNxGd92-5P7skNQLBw2Q. "selector" : "#kudosButtonV2", "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", "context" : "envParam:quiltName,message", "actions" : [ "defaultAriaLabel" : "", "action" : "rerender" "event" : "ProductAnswerComment", "actions" : [ { "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "context" : "", "context" : "envParam:quiltName,message", "useTruncatedSubject" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_1","feedbackSelector":".InfoMessage"}); }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "selector" : "#messageview_2", "parameters" : { "context" : "envParam:quiltName", } "event" : "MessagesWidgetEditCommentForm", "actions" : [ }, { } "context" : "", } }, }, "displayStyle" : "horizontal", "event" : "AcceptSolutionAction", "context" : "envParam:quiltName,product,contextId,contextUrl", } }, { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); }, }); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ;(function($) { // Reset the conditions so that someone can do it all again. ] "parameters" : { LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_31b7ad0dda7b1f","nodesModel":{"Archiv_Mobilfunk|forum-board":{"title":"Board-Suche: Archiv_Mobilfunk","inputSelector":".lia-search-input-message"},"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Archiv_Mobilfunk","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: Archiv_Mobilfunk","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_31b7ad0dda7b1f_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1889585 .lia-rating-control-passive', '#form_4'); }, // We made it! "entity" : "1889585", "context" : "", { { ;(function($) { "actions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ "event" : "kudoEntity", ] ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { { } "context" : "", } { "action" : "rerender" "componentId" : "kudos.widget.button", "componentId" : "forums.widget.message-view", "action" : "pulsate" "useCountToKudo" : "false", } // just for convenience, you need a login anyways... { Daher sehen wir nicht ein für die … "initiatorBinding" : true, { //$(window).scroll(function() { ] })(LITHIUM.jQuery); "event" : "removeThreadUserEmailSubscription", }else{ { { { }, "eventActions" : [ return; ] } else { }); } "context" : "", LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "actions" : [ { { { { LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; } "event" : "MessagesWidgetEditCommentForm", "actions" : [ { }, { ] }, LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "event" : "MessagesWidgetCommentForm", "actions" : [ "event" : "addThreadUserEmailSubscription", "dialogKey" : "dialogKey" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1888991 .lia-rating-control-passive', '#form'); "context" : "", { { "context" : "", { $(this).toggleClass("view-btn-open view-btn-close"); "actions" : [ "disableKudosForAnonUser" : "false", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "disableKudosForAnonUser" : "false", "initiatorDataMatcher" : "data-lia-message-uid" } { "disableLabelLinks" : "false", LITHIUM.Dialog.options['-2085844660'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, "action" : "rerender" { "actions" : [ "disableLabelLinks" : "false", }, }, "showCountOnly" : "false", } }, ] "initiatorBinding" : true, "event" : "approveMessage", "; }, $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "actions" : [ { } LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); ] { "disableKudosForAnonUser" : "false", "dialogKey" : "dialogKey" "event" : "AcceptSolutionAction", "linkDisabled" : "false" { "event" : "markAsSpamWithoutRedirect", $('#vodafone-community-header').toggle(); "useCountToKudo" : "false", "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "MessagesWidgetEditAction", { } { }); { "displaySubject" : "true", } { "action" : "rerender" }, "event" : "unapproveMessage", "event" : "addMessageUserEmailSubscription", "useSubjectIcons" : "true", ] "actions" : [ { { "context" : "", { "useTruncatedSubject" : "true", "event" : "ProductMessageEdit", ] $(this).next().toggle(); lithstudio: [], ] }, }, "context" : "", "context" : "", } "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "truncateBodyRetainsHtml" : "false", "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Zur Kabel-Hilfe Vodafone. "event" : "kudoEntity", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_31b7ad0eb88dc7', 'disableAutoComplete', '#ajaxfeedback_31b7ad0dda7b1f_0', 'LITHIUM:ajaxError', {}, '6-EXeasYCmvHC6EkonqgODFFkCXQtc13ko8zxCD1rOs. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { } }, } "accessibility" : false, { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1889185 .lia-rating-control-passive', '#form_3'); "action" : "rerender" "event" : "RevokeSolutionAction", }, "event" : "addThreadUserEmailSubscription", } ', 'ajax'); { "action" : "pulsate" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetMessageEdit", "componentId" : "kudos.widget.button", "event" : "AcceptSolutionAction", LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; { "action" : "rerender" { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_31b7ad0dda7b1f","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_31b7ad0dda7b1f_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/Archiv_Mobilfunk/thread-id/234563&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"gYUGluH_ngBbwleW7ety3tvxg6tGljuodhQnIviJyUs. "action" : "rerender" "action" : "rerender" { "kudosLinksDisabled" : "false", }, "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1804355,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "envParam:quiltName,message", LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { window.location.replace('/t5/user/userloginpage'); "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "", { }, "action" : "rerender" { "action" : "rerender" "actions" : [ }, } "parameters" : { LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "event" : "addMessageUserEmailSubscription", "useSubjectIcons" : "true", "context" : "lia-deleted-state", "event" : "RevokeSolutionAction", "action" : "rerender" { } In rechtlicher Hinsicht greift auch bei einem Surfstick der Kostenschutz. }, ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "editProductMessage", "useSimpleView" : "false", "event" : "MessagesWidgetEditCommentForm", "event" : "approveMessage", { // If watching, pay attention to key presses, looking for right sequence. "action" : "rerender" ] LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ { "message" : "1889185", ] "event" : "MessagesWidgetEditAction", LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'F7UQdcOYgN_JscGyMQiGFDvTFXCy2KQ2F_6Lpps_KSg. }, else { "event" : "ProductAnswerComment", habe ich nicht bekommen. "actions" : [ ] }, { $('#vodafone-community-header .lia-search-toggle').click(function() { } "context" : "lia-deleted-state", } "event" : "MessagesWidgetEditCommentForm", logmein: [76, 79, 71, 77, 69, 73, 78], "action" : "rerender" { "action" : "rerender" "parameters" : { "linkDisabled" : "false" "quiltName" : "ForumMessage", "actions" : [ ] LITHIUM.Dialog({ "event" : "removeMessageUserEmailSubscription", LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "expandMessage", ] { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/225454","ajaxErrorEventName":"LITHIUM:ajaxError","token":"kQiGNFXg2W4xwqsfhTYUbzfNy6NF2tLqegK1L6rAFHU. "event" : "MessagesWidgetAnswerForm", { { "context" : "envParam:feedbackData", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); watching = false; $(document).ready(function(){ { } Bist du sicher, dass du fortfahren möchtest? { "truncateBody" : "true", { { { "selector" : "#messageview_4", "context" : "", "context" : "", { } "actions" : [ LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); "action" : "addClassName" "event" : "removeMessageUserEmailSubscription", "action" : "pulsate" ] }, "context" : "", "actions" : [ { "action" : "rerender" "linkDisabled" : "false" { }, "actions" : [ ] "displaySubject" : "true", "useSimpleView" : "false", Diese stehen etwa auf Rechnungen oder in E-Mails des Unternehmens. ] { })(LITHIUM.jQuery); // Pull in global jQuery reference "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ "context" : "", "action" : "rerender" Ich kann hier auch nur das bestätigen, was unsere SuperUser schon geschrieben haben: Bei Vertragsabschluss/- verlängerung im Shop versuche bitte zunächst darüber eine Klärung. } "context" : "", "event" : "addMessageUserEmailSubscription", "revokeMode" : "true", { "kudosLinksDisabled" : "false", count = 0; "context" : "", $(event.data.selector).removeClass('cssmenu-open'); "event" : "MessagesWidgetAnswerForm", "dialogContentCssClass" : "lia-panel-dialog-content", return; { "action" : "addClassName" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); } } "actions" : [ "disableLinks" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); { "initiatorDataMatcher" : "data-lia-message-uid" "event" : "kudoEntity", { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "message" : "1889585", "disableKudosForAnonUser" : "false", { { "useSimpleView" : "false", ', 'ajax'); { "context" : "lia-deleted-state", { "selector" : "#messageview_2", "kudosLinksDisabled" : "false", }, }, { "message" : "1889585", "event" : "ProductMessageEdit", { }); "actions" : [ "triggerEvent" : "LITHIUM:triggerDialogEvent", "actions" : [ }, "action" : "rerender" { "context" : "", "event" : "approveMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ "buttonDialogCloseAlt" : "Schließen", "forceSearchRequestParameterForBlurbBuilder" : "false", } { } "action" : "rerender" } { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "action" : "rerender" "truncateBody" : "true", { ] { }, "disableKudosForAnonUser" : "false", count = 0; LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "actions" : [ "context" : "", } "message" : "1888998", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1889585 .lia-rating-control-passive', '#form_4'); ', 'ajax'); { ] "event" : "MessagesWidgetMessageEdit", "event" : "MessagesWidgetEditAnswerForm", ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, ] { "context" : "", "context" : "", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "ProductAnswer", { }); { { "action" : "rerender" "eventActions" : [ "displayStyle" : "horizontal", }, "parameters" : { if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { "actions" : [ var count = 0; "disableKudosForAnonUser" : "false", "actions" : [ ] } { "event" : "removeThreadUserEmailSubscription", "context" : "", } "context" : "", "event" : "ProductAnswerComment", logmein: [76, 79, 71, 77, 69, 73, 78], "event" : "kudoEntity", }, ] { sessionStorage.setItem("is_scroll", option); } { ] "event" : "removeThreadUserEmailSubscription", { { "action" : "rerender" }, "actions" : [ { "initiatorDataMatcher" : "data-lia-message-uid" "truncateBody" : "true", LITHIUM.Loader.runJsAttached(); "action" : "rerender" { $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); "selector" : "#kudosButtonV2_0", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", { { ] { // console.log(key); ] LITHIUM.Dialog({ .attr('aria-hidden','true') { "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Archiv_Mobilfunk/thread-id/225454","ajaxErrorEventName":"LITHIUM:ajaxError","token":"soEIzMknx3kYQXngXE5_wbfn6DMU0WRBRO2rZeVat0E. window.location.replace('/t5/user/userloginpage'); { { ] "context" : "", "action" : "pulsate" ] "context" : "envParam:quiltName,expandedQuiltName", }, ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "deleteMessage", } LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, { }, "context" : "", { ] "initiatorBinding" : true, "eventActions" : [ { "action" : "rerender" "event" : "approveMessage", "useSubjectIcons" : "true", { "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" { "action" : "rerender" { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/225454","ajaxErrorEventName":"LITHIUM:ajaxError","token":"vPKmkyZzatxJCWvliDvEJaEcx5WTbqiRiFqJ51vgrS0. { count = 0; ] var notifCount = 0; } { LITHIUM.AjaxSupport.ComponentEvents.set({ "displaySubject" : "true", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Archiv_Mobilfunk/thread-id/234563","ajaxErrorEventName":"LITHIUM:ajaxError","token":"PeI89zEO6ozv9qSyEYGGcKVaojRCMeeJhk68UAkWyXQ. "context" : "", "actions" : [ "action" : "rerender" LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; } { "actions" : [ "showCountOnly" : "false", } "event" : "AcceptSolutionAction", "eventActions" : [ "actions" : [ "actions" : [ { "}); ] "context" : "", } "event" : "removeMessageUserEmailSubscription", "event" : "MessagesWidgetCommentForm", { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "context" : "", "context" : "envParam:quiltName,product,contextId,contextUrl", $('#node-menu li.has-sub>a').on('click', function(){ "actions" : [ }, ] $('#node-menu li.has-sub>a').on('click', function(){ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/234563","ajaxErrorEventName":"LITHIUM:ajaxError","token":"__qwfcNObk9R7Id0W8VYK0wEEV3QSgrTGvoqJ5WCYc0. "componentId" : "kudos.widget.button", ] ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); "disableLinks" : "false", { }); } "disableLinks" : "false", { ], LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; }, "disableKudosForAnonUser" : "false", "event" : "expandMessage", "action" : "rerender" { "context" : "", { { "parameters" : { "actions" : [ "action" : "rerender" "selector" : "#messageview_3", var key = e.keyCode; { "actions" : [ "event" : "markAsSpamWithoutRedirect", "action" : "rerender" "action" : "rerender" "displaySubject" : "true", "action" : "addClassName" if ( !watching ) { "event" : "ProductMessageEdit", // console.log(key); } "actions" : [ ] } count = 0; LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "event" : "expandMessage", "actions" : [ count = 0; ] },